PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_BA2B07F73.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 68aa    MW: 8034.22 Da    PI: 9.1282
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_BA2B07F73.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR142.12.9e-1320654490
                   FAR1 44 ekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                           + kk++ +r++ +  +tgCkak+ vk   dg+wev+ +++eHnH+l+
  Traes_7DS_BA2B07F73.1 20 KGKKRSMKRKRDKIVQTGCKAKMIVKVI-DGRWEVIYFVSEHNHPLV 65
                           3333678899999***************.****************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.3E-111865IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
EQEKNDNEDE AIVFLDDDSK GKKRSMKRKR DKIVQTGCKA KMIVKVIDGR WEVIYFVSEH  60
NHPLVYKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703064e-91HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229906.11e-15PREDICTED: uncharacterized protein LOC100830996
TrEMBLW5IAB85e-44W5IAB8_WHEAT; Uncharacterized protein
STRINGMLOC_41261.14e-20(Hordeum vulgare)
STRINGMLOC_74313.16e-20(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP9528843
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]